- RIIAD1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-94117
- Unconjugated
- Human
- Immunohistochemistry, Immunohistochemistry-Paraffin
- RIIAD1
- Rabbit
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: METLPGLLQR PDPGALSAAQ LEQLRKFKIQ TRIANEKYLR THKEVEWLIS GFFREIFLKR PDNILEFAAD YFTDPRLPNK IH
- C1orf230, NCRNA00166
- regulatory subunit of type II PKA R-subunit domain containing 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIH
Specifications/Features
Available conjugates: Unconjugated